PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim12g006800.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 440aa    MW: 48722 Da    PI: 7.1683
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim12g006800.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.5e-32239294156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Sopim12g006800.0.1 239 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 294
                         68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.22236296IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-28237297IPR009057Homeodomain-like
SuperFamilySSF466891.79E-16237297IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26239294IPR006447Myb domain, plants
PfamPF002497.5E-7241292IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MNMASSNSEL SLECKPHQSY SMLLKSFGEK NVDQTQNLEE FLTRLEEERV KIDAFKRELP  60
LCMQLLTNAM EASRQQLHSH RENNHIGQMR PVLEEFIPLK NNNASVELGD EKLVANNTST  120
IVDNKANWMT SAQLWSPPSD HQETKQQVQI STTCNKENDH HNNIGFSIAS KLALDNNNSS  180
CPSPTTLALA SSNKQNNNET LLQVEDNNKN LEIQQDSQGI GGGTNSTSTS TQQQQPHRKA  240
RRCWSPDLHR RFVNALQMLG GSQVATPKQI RELMKVDGLT NDEVKSHLQK YRLHTRRPSP  300
SPQATTAPPH LVVLGGIWVP PEYAAAAAHG GAPPTATFYG PHSTSHAPSP HYIAAPQALA  360
QEFYNTPQPL QTLHHQQLYH PGSHMYKPSP KAHSHSSPES DARGTGQHGD RSSESIEDGK  420
SESYSSENGG ERKVVVHKF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755240.0HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251582.10.0PREDICTED: transcription factor LUX
TrEMBLK4DBL70.0K4DBL7_SOLLC; Uncharacterized protein
STRINGSolyc12g006800.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87942229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-77G2-like family protein